PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.160
Common NameAMTR_s00021p00196860, LOC18442269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family VOZ
Protein Properties Length: 490aa    MW: 54716.1 Da    PI: 5.0762
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.160genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ429.64.5e-1322144291216
                                       VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsak 69 
                                               pppsaflgpkcalwdc+rpaqgsew++dycs +hat+alneg+pg+tpvlrp+gidlkdg+lf+al a+
  evm_27.model.AmTr_v1.0_scaffold00021.160 214 PPPSAFLGPKCALWDCPRPAQGSEWCRDYCSDLHATMALNEGPPGMTPVLRPGGIDLKDGPLFSALCAR 282
                                               89******************************************************************* PP

                                       VOZ  70 vqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwh 138
                                               +qgk vgipecegaat+kspwna+elfdls+lege+irewlffdkprrafesgnrkqrslpdy grgwh
  evm_27.model.AmTr_v1.0_scaffold00021.160 283 TQGKAVGIPECEGAATTKSPWNAPELFDLSVLEGESIREWLFFDKPRRAFESGNRKQRSLPDYCGRGWH 351
                                               ********************************************************************* PP

                                       VOZ 139 esrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdslad 207
                                               esrkqvmk+fgglkrsyymdpqp+++fewhlyeyein++d++alyrlelk+vd+kk+akgk + dsl+d
  evm_27.model.AmTr_v1.0_scaffold00021.160 352 ESRKQVMKDFGGLKRSYYMDPQPLTQFEWHLYEYEINNCDTYALYRLELKQVDGKKNAKGKNMGDSLVD 420
                                               ********************************************************************* PP

                                       VOZ 208 lqkklgrlt 216
                                               lq+++grlt
  evm_27.model.AmTr_v1.0_scaffold00021.160 421 LQQQMGRLT 429
                                               *******98 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MGKGLKNGVS KSSSQRVFKD KAKTKVDDLQ GMFNDLQCAR KESRPNDVAV LEEQVHQMLR  60
EWKAELNEAS PTSSLLAGSL GSSELSSDMR RLLQLHEEDD DATSALAPPA SPKLHCDAHN  120
IQAQDAEFHD DFYTNQASQQ QAFHEINGRE GIHSEDLTNN LNDGLEGSIL LEDYQFSLYQ  180
DFTNNLCLGF GMTSREGDNL LCSIPNPPLG MCPPPPSAFL GPKCALWDCP RPAQGSEWCR  240
DYCSDLHATM ALNEGPPGMT PVLRPGGIDL KDGPLFSALC ARTQGKAVGI PECEGAATTK  300
SPWNAPELFD LSVLEGESIR EWLFFDKPRR AFESGNRKQR SLPDYCGRGW HESRKQVMKD  360
FGGLKRSYYM DPQPLTQFEW HLYEYEINNC DTYALYRLEL KQVDGKKNAK GKNMGDSLVD  420
LQQQMGRLTS EYPADSKRNV KGRAKLVQKV KAKNGYSTPN QTNPNDNFDY GTGPQYGYFV  480
DDLNDYYGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852554.10.0PREDICTED: transcription factor VOZ1
RefseqXP_011626288.10.0PREDICTED: transcription factor VOZ1
RefseqXP_011626289.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLW1Q0P10.0W1Q0P1_AMBTC; Uncharacterized protein
STRINGVIT_12s0028g02670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-180vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]